PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do017830.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family bZIP
Protein Properties Length: 279aa    MW: 29924.4 Da    PI: 5.87
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do017830.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.91.2e-091682201163
                 HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1  11 qkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l +l+   + l++e+
  Do017830.1 168 LANRQSAARSKERKMRYIAELERKVQTLQSEATTLSAQLAMLQRDTSGLTNEN 220
                 56****************************************99999888877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.8E-12147222IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.73E-10165217No hitNo description
Gene3DG3DSA:1.20.5.1701.5E-10166217No hitNo description
CDDcd147033.41E-23166212No hitNo description
PROSITE profilePS502179.933166223IPR004827Basic-leucine zipper domain
PfamPF001702.4E-7167219IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MPSSPTSPPR RGAGHRRAQS EILLGGAALP DDLTFDADLG VVGEACGAGD EDEEDDDEYE  60
DGGSGAGGSR MFEMFLENGG TLPGPPEPSA HPHPAATTPP PRPRHHHSMS MDGSTSLLGS  120
AAAGTPGRVG ADAKKAISDA KLAELALVDP KRAKSNLIFT FVTHFRILAN RQSAARSKER  180
KMRYIAELER KVQTLQSEAT TLSAQLAMLQ RDTSGLTNEN SDLKIRVQTM EQQVRLQDAL  240
NDRLRDEVQQ LKIATGQAPL TTMPSRANPE GLAWIHASF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002448110.11e-134hypothetical protein SORBIDRAFT_06g021350
SwissprotQ040887e-72POF21_ARATH; Probable transcription factor PosF21
TrEMBLC0PDU91e-141C0PDU9_MAIZE; BZIP transcription factor
STRINGGRMZM2G112483_P011e-140(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123022937
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.13e-58bZIP family protein